PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11766_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 217aa    MW: 25441.4 Da    PI: 10.1892
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11766_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.3e-192067148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEd ll+++vk++G g+W++++r  g++R +k+c++rw +yl
  cra_locus_11766_iso_2_len_949_ver_3 20 KGPWTAEEDRLLIEYVKLHGEGRWNSVSRLAGLKRNGKSCRLRWVNYL 67
                                         79********************************************97 PP

2Myb_DNA-binding53.55.4e-1773117147
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          rg  T+ E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  cra_locus_11766_iso_2_len_949_ver_3  73 RGQITPHEESIIVELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 117
                                          7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6381571IPR017930Myb domain
SuperFamilySSF466891.48E-3017114IPR009057Homeodomain-like
SMARTSM007175.9E-171969IPR001005SANT/Myb domain
PfamPF002499.7E-182067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-232174IPR009057Homeodomain-like
CDDcd001671.66E-112267No hitNo description
SMARTSM007171.5E-1472120IPR001005SANT/Myb domain
PROSITE profilePS5129419.49372122IPR017930Myb domain
PfamPF002496.8E-1473117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2475122IPR009057Homeodomain-like
CDDcd001672.19E-977118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MAAASHEPLG WGMVEEGWRK GPWTAEEDRL LIEYVKLHGE GRWNSVSRLA GLKRNGKSCR  60
LRWVNYLRPD LKRGQITPHE ESIIVELHAR WGNRWSTIAR SLPGRTDNEI KNYWRTHFKK  120
KVKSPNDNNS EKVRARLLKR QQYHQQQQQH QQQQQMHQAQ DQILDMKRLM SFLEENEDHV  180
SSAAAAGGGG IIFSDTSNEH QNHHHQQQQQ SKDFFIP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-272012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285781.12e-92hypothetical protein CARUB_v10007255mg
TrEMBLR0GP772e-92R0GP77_9BRAS; Uncharacterized protein
STRINGBra015029.1-P9e-89(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154